Gene Rv3000
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv3000, (MTV012.14), len: 219 aa. Possible conserved transmembrane protein, similar to various membrane proteins e.g. P77307|YBBM_ECOLI|B0491 hypothetical 28.2 KDA protein (potential integral membrane protein) from Escherichia coli strain K12 (259 aa), FASTA scores: opt: 292, E(): 3.1e-11, (30.25% identity in 218 aa overlap); N-terminus of Q9BJF3 putative ABC transporter (fragment) from Sterkiella histriomuscorum (1319 aa), FASTA scores: opt: 274, E(): 1.3e-09, (39.6% identity in 101 aa overlap); Q9C9W0|T23K23.21 putative ABC transporter from Arabidopsis thaliana (Mouse-ear cress) (263 aa), FASTA scores: opt: 258, E(): 4.4e-09, (30.1% identity in 196 aa overlap); P74369|YG47_SYNY3|SLR1647 hypothetical 28.1 KDA protein (potential integral membrane protein) from Synechocystis sp. strain PCC 6803 (259 aa), FASTA scores: opt: 257, E(): 5.1e-09, (37.75% identity in 98 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3358612 | 3359271 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3000|Rv3000
MAVHGFLLERVSVVRDEATVLRQVSAHFPAGRCSAVRGASGSGKTTLLRLLNRLIDPTSGKVWLDGVPLTDLDVLVLRRRVGLVAQAPVVLTDAVLNEVRVGRPDLPEGRVTELLARLCLGQSAREAFLPHQRSALRTALIPAIDSTKVVGLISLPGAMSGLILAGVDPLTAIRYQIVVMYLLLAATAVAALTCARLAERALFDRAHRLVSLPAATRRA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
