Gene Mb3046c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esat-6 like protein esxs |
| Comments | Mb3046c, esxS, len: 97 aa. Equivalent to Rv3020c,len: 97 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 97 aa overlap). Member of Mycobacterium tuberculosis PE family (see first citation below), similar to others e.g. AAK44524|MT0300 PE FAMILY PROTEIN from M. tuberculosis strain CDC1551 (97 aa), FASTA scores: opt: 564, E(): 5.9e-30, (91.75% identity in 97 aa overlap). Has potential helix-turn-helix motif at positions 14-35. TBparse score is 0.912. SEEMS TO BELONG TO THE ESAT6 FAMILY (see second citation below). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3335595 | 3335888 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3046c|esxS
MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF
Bibliography
No article yet recorded