Gene Rv3020c (PE28)
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | ESAT-6 like protein EsxS |
Comments | Rv3020c, (MTV012.34c), len: 97 aa. EsxS, ESAT-6 like protein. PE-family related protein; distant member of the Mycobacterium tuberculosis PE family, similar to AAK44524|MT0300 PE family protein from M. tuberculosis strain CDC1551 (97 aa), FASTA scores: opt: 564, E(): 5.9e-30, (91.75% identity in 97 aa overlap). Has potential helix-turn-helix motif at positions 14-35. Seems to belong to the ESAT6 family (see Betts et al., 2002). Note that previously known as PE28. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
Functional category | Cell wall and cell processes |
Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3379036 | 3379329 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv3020c|3379036-3379329|-|esxS|downstream:0|upstream:0 atgagtttgttggatgcccatattccgcagttgatcgcttcgcatacggcgtttgccgctaaggcggggttgatgcggcatacgatcggtcaggccgagcagcaggcgatgtcggcgcaggcgtttcatcagggagagtccgcggcggcgtttcagggtgcgcatgcccggtttgtggccgcggccgccaaggtcaataccttgctggatatcgcgcaagccaatttgggtgaggccgcgggcacgtatgtggccgccgatgccgccgccgcgtccagctacaccgggttttaa
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3020c|esxS MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF
Bibliography
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant