Gene Mb3048c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe29 |
| Comments | Mb3048c, PE29, len: 104 aa. Equivalent to Rv3022A,len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). Member of the Mycobacterium tuberculosis PE family, similar to many others e.g. Rv0285|AL021930_12 from Mycobacterium tuberculosis (102 aa), FASTA scores: opt: 497, E(): 3e-21,(80.39% identity in 102 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3337239 | 3337553 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3048c|PE29
MTLRVVPEGLAAASAAVEALTARLAAAHAGAAPAITAVVAPAADPVSLQSAVGFSALGSEHAAIAGEGVEELGRSGVAVGESGIGYAAGDAVAAATYLVSGGSL
Bibliography
No article yet recorded