Gene Rv3022A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE29 |
| Comments | Rv3022A, len: 104 aa. PE29, Member of the Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), similar to many others e.g. Rv0285|AL021930_12 from Mycobacterium tuberculosis (102 aa), FASTA scores: opt: 497, E(): 3e-21, (80.39% identity in 102 aa overlap); etc. |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3380679 | 3380993 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3022A|PE29
VTLRVVPEGLAAASAAVEALTARLAAAHAGAAPAITAVVAPAADPVSLQSAVGFSALGSEHAAIAGEGVEELGRSGVAVGESGIGYAAGDAVAAATYLVSGGSL
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant