Gene Mb3096
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | Mb3096, -, len: 132 aa. Equivalent to Rv3069, len: 132 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 132 aa overlap). Probable conserved transmembrane protein, similar to several hypothetical and CRCB bacterial proteins e.g. Q9A6V2|CC1981 CRCB PROTEIN (see citation below; seems to be involved in camphor resistance and chromosome condensation, promoting or protecting chromosome folding) from Caulobacter crescentus (127 aa), FASTA scores: opt: 275, E(): 1.6e-11, (41.1% identity in 124 aa overlap); Q9FC39|SC4G1.10 PUTATIVE INTEGRAL MEMBRANE PROTEIN from Streptomyces coelicolor (154 aa), FASTA scores: opt: 258, E(): 2.5e-10, (42.15% identity in 121 aa overlap); Q9V0X2|PAB1925 CRCB PROTEIN (see citation below) from Pyrococcus abyssi (123 aa),FASTA scores: opt: 256, E(): 2.8e-10, (39.8% identity in 113 aa overlap); O59171|PH1502 HYPOTHETICAL 13.6 KDA PROTEIN from Pyrococcus horikoshii (123 aa), FASTA scores: opt: 249, E(): 8.2e-10, (38.65% identity in 119 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3390239 | 3390637 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3096|Mb3096
MPNHDYRELAAVFAGGALGALARAALSALAIPDPARWPWPTFTVNVVGAFLVGYFTTRLLERLPLSSYRRPLLGTGLCGGLTTFSTMQVETISMIEHGHWGLAAAYSVVSITLGLLAVHLATVLVRRVRIRR
Bibliography
No article yet recorded
