Gene Rv3069
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Rv3069, (MTCY22D7.12c), len: 132 aa. Probable conserved transmembrane protein, similar to several hypothetical and CRCB bacterial proteins e.g. Q9A6V2|CC1981 CRCB protein (see citation below; seems to be involved in camphor resistance and chromosome condensation, promoting or protecting chromosome folding) from Caulobacter crescentus (127 aa), FASTA scores: opt: 275, E(): 1.6e-11, (41.1% identity in 124 aa overlap); Q9FC39|SC4G1.10 putative integral membrane protein from Streptomyces coelicolor (154 aa), FASTA scores: opt: 258, E(): 2.5e-10, (42.15% identity in 121 aa overlap); Q9V0X2|PAB1925 CRCB protein (see citation below) from Pyrococcus abyssi (123 aa), FASTA scores: opt: 256, E(): 2.8e-10, (39.8% identity in 113 aa overlap); O59171|PH1502 hypothetical 13.6 KDA protein from Pyrococcus horikoshii (123 aa), FASTA scores: opt: 249, E(): 8.2e-10, (38.65% identity in 119 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3433692 | 3434090 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3069|Rv3069
VPNHDYRELAAVFAGGALGALARAALSALAIPDPARWPWPTFTVNVVGAFLVGYFTTRLLERLPLSSYRRPLLGTGLCGGLTTFSTMQVETISMIEHGHWGLAAAYSVVSITLGLLAVHLATVLVRRVRIRR
Bibliography
- Hu KH et al. [1996]. Overproduction of three genes leads to camphor resistance and chromosome condensation in Escherichia coli. Secondary Homolog Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Bu L et al. [2008]. De novo prediction of the structures of M. tuberculosis membrane proteins. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant