Gene Mb3105
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE HYDROXYLAMINOBENZENE MUTASE HAB |
| Comments | Mb3105, hab, len: 133 aa. Equivalent to Rv3078,len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Probable hab,hydroxylaminobenzene mutase (5.-.-.-) (see experiments in first citation), highly similar to two hydroxylaminobenzene mutases from Pseudomonas pseudoalcaligenes O52214|HABA (135 aa), FASTA scores: opt: 495, E(): 6.8e-25, (51.1% identity in 133 aa overlap); and O52216|HABB (164 aa), FASTA scores: opt: 479, E(): 8.2e-24, (51.9% identity in 133 aa overlap) (see first citation); and to Q9AH35|NBZB HYDROXYLAMINOBENZENE MUTASE from Pseudomonas putida (164 aa), FASTA scores: opt: 476,E(): 1.3e-23, (51.8% identity in 133 aa overlap) (see second citation). Gene name according to Pseudomonas pseudoalcaligenes nomenclature. Also similarity with putative different membrane proteins involved in transport (protein predicted to be a transmembrane protein). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3397900 | 3398301 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3105|hab
MQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPEAWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHKAPAAKEGFVSFLLLSLSVAIVIGVVIVIIGL
Bibliography
No article yet recorded