Gene Mb3204
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3204, -, len: 119 aa. Equivalent to Rv3178, len: 119 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 119 aa overlap). Hypothetical protein,with some similarity to other hypothetical bacterial proteins (principaly mycobacterium and streptomyces proteins) e.g. P71854|Rv3547|MTCY03C7.09c from M. tuberculosis strain H37Rv (151 aa), FASTA scores: opt: 310, E(): 2e-14, (40.5% identity in 116 aa overlap); Q9ZH81 from M. paratuberculosis (144 aa), FASTA scores: opt: 274, E(): 5.6e-12, (38.9% identity in 108 aa overlap); O85698|3SCF60.07 from Streptomyces lividans and Streptomyces coelicolor (149 aa), FASTA scores: opt: 235,E(): 2.7e-09, (35.2% identity in 108 aa overlap); Q10772|YF58_MYCTU|Rv1558|MT1609|MTCY48.07c (148 aa); Q9WX21|SCE68.11 from Streptomyces coelicolor (305 aa); etc. Equivalent to AAK47606 from Mycobacterium tuberculosis strain CDC1551 (171 aa) but shorter 52 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3503688 | 3504047 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3204|Mb3204
MRLGAGFRKPVPTLLLEHRSRKSGKNFVAPLLYITDRNNVIVVASALGQAENPQWYRNLPPNPDTHIQIGSDRRPVRAVVASSDERARLWPRPVDAYADFDSCQSWTERGIPVIILRPR
Bibliography
No article yet recorded