Gene Rv3178
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3178, (MTV014.22), len: 119 aa. Hypothetical protein, with some similarity to other hypothetical bacterial proteins (principally mycobacterium and streptomyces proteins) e.g. P71854|Rv3547|MTCY03C7.09c from Mycobacterium tuberculosis strain H37Rv (151 aa), FASTA scores: opt: 310, E(): 2e-14, (40.5% identity in 116 aa overlap); Q9ZH81 from M. paratuberculosis (144 aa), FASTA scores: opt: 274, E(): 5.6e-12, (38.9% identity in 108 aa overlap); O85698|3SCF60.07 from Streptomyces lividans and Streptomyces coelicolor (149 aa), FASTA scores: opt: 235, E(): 2.7e-09, (35.2% identity in 108 aa overlap); Q10772|YF58_MYCTU|Rv1558|MT1609|MTCY48.07c (148 aa); Q9WX21|SCE68.11 from Streptomyces coelicolor (305 aa); etc. Equivalent to AAK47606 from Mycobacterium tuberculosis strain CDC1551 (171 aa) but shorter 52 aa. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3546438 | 3546797 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3178|Rv3178
LRLGAGFRKPVPTLLLEHRSRKSGKNFVAPLLYITDRNNVIVVASALGQAENPQWYRNLPPNPDTHIQIGSDRRPVRAVVASSDERARLWPRPVDAYADFDSCQSWTERGIPVIILRPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant