Gene Mb3235
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical threonine and proline rich protein |
| Comments | Mb3235, -, len: 186 aa. Equivalent to Rv3209, len: 186 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 186 aa overlap). Conserved hypothetical thr-, pro-rich protein, equivalent (but shorter 36 aa in N-terminus) to Q9CCH2|ML0813 PUTATIVE MEMBRANE PROTEIN from Mycobacterium leprae (195 aa), FASTA scores: opt: 508, E(): 1.4e-15, (58.4% identity in 185 aa overlap). Also some similarity with Q10390|MMS3_MYCTU|MMPS3|Rv2198c|MT2254|MTCY190.09c PROBABLE CONSERVED TRANSMEMBRANE TRANSPORT PROTEIN from M. tuberculosis (299 aa), FASTA scores: opt: 339, E(): 3.7e-08, (35.0% identity in 180 aa overlap); and Q9CCE9|MMPS3|ML0877 PUTATIVE MEMBRANE PROTEIN from Mycobacterium leprae (293 aa), FASTA scores: opt: 272,E(): 2.8e-05, (36.4% identity in 173 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3540815 | 3541375 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3235|Mb3235
MALGAVATAVIINSGDSTSTKAIVGAPAPRTVISTSPRPTAPTSTSPHPSPSTLRPQLPPETVTTVAPPGTGPTTVPTRTPTAAPPQTAVPPPAPLNPRTVVYRVTGTKQLFDLVNVVYTDARGFPVTDFNVSLPWTKMVVLNPGVQTESVVATSLYSRLNCSIVNTGAQTVVASTNNAIIATCTR
Bibliography
No article yet recorded
