Gene Mb3245
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein whib-like whib1. contains [4fe-4s]2+ cluster. |
| Comments | Mb3245, whiB1, len: 84 aa. Equivalent to Rv3219,len: 84 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 84 aa overlap). Probable whiB1,WhiB-like regulatory protein (see citation below), similar to WhiB paralogue of Streptomyces coelicolor. Equivalent to Q9CCH7|WHIB1|ML0804 PUTATIVE TRANSCRIPTIONAL REGULATOR from Mycobacterium leprae (84 aa), FASTA scores: opt: 580,E(): 3.5e-35, (95.25% identity in 84 aa overlap). Highly similar to several e.g. Q9X952|WBLE DEVELOPMENTAL REGULATORY PROTEIN WHIB-PARALOG from Streptomyces coelicolor (85 aa), FASTA scores: opt: 477, E(): 9.2e-28,(75.3% identity in 81 aa overlap); Q9AD55|SCP1.95 PUTATIVE REGULATORY PROTEIN from Streptomyces coelicolor (102 aa),FASTA scores: opt: 383, E(): 6.1e-21, (60.75% identity in 79 aa overlap); Q9K4K8|SC5F8.16c from Streptomyces coelicolor (83 aa), FASTA scores: opt: 346, E(): 2.5e-18,(54.75% identity in 84 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3550312 | 3550566 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3245|whiB1
MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRALKRRNARTKARTGV
Bibliography
No article yet recorded
