Gene Mb3248c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | anti-sigma factor rsha |
Comments | Mb3248c, -, len: 101 aa. Equivalent to Rv3221A,len: 101 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 101 aa overlap). Possible anti-sigma factor, similar to Q9XCD7|AAD41811.1 unknown protein from Mycobacterium smegmatis, linked to sigma factor sigH (see first citation below) (101 aa), FASTA scores: opt: 422,E(): 3.4e-22, (64.9% identity in 94 aa overlap); and to Q9RL96|RsrA anti-sigma factor from Streptomyces coelicolor (see second citation) (105 aa), FASTA scores: opt: 163,E(): 0.00016, (32.05% identity in 78 aa overlap). |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3552650 | 3552955 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3248c|rsha MSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHYGLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP
Bibliography
No article yet recorded