Gene Mb3278c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE RUBREDOXIN RUBB |
| Comments | Mb3278c, -, len: 60 aa. Equivalent to Rv3250c, len: 60 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 60 aa overlap). Probable rubB,rubredoxin, highly similar to other rubredoxins e.g. Q9AE66|RUBA4 from Rhodococcus erythropolis (60 aa), FASTA scores: opt: 391, E(): 2.2e-21, (83.05% identity in 59 aa overlap); Q9AE63|RUBA2 from Rhodococcus erythropolis (63 aa), FASTA scores: opt: 380, E(): 1.4e-20, (83.9% identity in 56 aa overlap); P42453|RUBR_ACICA|RUBA from Acinetobacter calcoaceticus (54 aa), FASTA scores: opt: 315, E(): 4.9e-16, (69.8% identity in 53 aa overlap); Q9HTK7|PA5351 from Pseudomonas aeruginosa (55 aa), FASTA scores: opt: 298, E(): 8e-15, (64.15% identity in 53 aa overlap); Q9PGC3|XF0379 from Xylella fastidiosa (57 aa),FASTA scores: opt: 263, E(): 2.5e-12, (59.25% identity in 54 aa overlap); etc. Also similar to neighbouring ORF M. tuberculosis RubA (MTCY20B11.26c). Contains rubredoxin signature (PS00202). BELONGS TO THE RUBREDOXIN FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3584984 | 3585166 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3278c|rubB
MNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVEVARS
Bibliography
No article yet recorded