Gene Rv3250c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the hydrocarbon hydroxylating system to convert conversion of dodecane to lauric acid, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase. |
| Product | Probable rubredoxin RubB |
| Comments | Rv3250c, (MTCY20B11.25c), len: 60 aa. Probable rubB, rubredoxin, highly similar to other rubredoxins e.g. Q9AE66|RUBA4 from Rhodococcus erythropolis (60 aa), FASTA scores: opt: 391, E(): 2.2e-21, (83.05% identity in 59 aa overlap); Q9AE63|RUBA2 from Rhodococcus erythropolis (63 aa), FASTA scores: opt: 380, E(): 1.4e-20, (83.9% identity in 56 aa overlap); P42453|RUBR_ACICA|RUBA from Acinetobacter calcoaceticus (54 aa), FASTA scores: opt: 315, E(): 4.9e-16, (69.8% identity in 53 aa overlap); Q9HTK7|PA5351 from Pseudomonas aeruginosa (55 aa), FASTA scores: opt: 298, E(): 8e-15, (64.15% identity in 53 aa overlap); Q9PGC3|XF0379 from Xylella fastidiosa (57 aa), FASTA scores: opt: 263, E(): 2.5e-12, (59.25% identity in 54 aa overlap); etc. Also similar to neighbouring ORF M. tuberculosis RubA (MTCY20B11.26c). Contains rubredoxin signature (PS00202). Belongs to the rubredoxin family. |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3630384 | 3630566 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3250c|rubB
VNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVEVARS
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
