Gene Mb3279c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE RUBREDOXIN RUBA |
| Comments | Mb3279c, -, len: 55 aa. Equivalent to Rv3251c, len: 55 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 55 aa overlap). Probable rubA,rubredoxin, highly similar to other rubredoxins (but sometimes shorter) e.g. Q9AE67|RUBA3 from Rhodococcus erythropolis (61 aa), FASTA scores: opt: 335, E(): 1e-17,(73.6% identity in 53 aa overlap); P00272|RUB2_PSEOL|ALKG from Pseudomonas oleovorans (172 aa), FASTA scores: opt: 278, E(): 2.7e-13, (65.3% identity in 49 aa overlap); CAC38028|ALKG from Alcanivorax borkumensis (174 aa), FASTA scores: opt: 271, E(): 8.6e-13, (62.0% identity in 50 aa overlap); Q9WWW4|ALKG from Pseudomonas putida (175 aa),FASTA scores: opt: 270, E(): 1e-12, (61.8% identity in 55 aa overlap); etc. Also highly similar to C-terminus of Q9XBM1|ALKB ALKANE 1-MONOOXYGENASE (EC 1.14.15.3) from Prauserella rugosa (490 aa), FASTA scores: opt: 296, E(): 2.9e-14, (75.5% identity in 49 aa overlap). Also similar to neighbouring ORF Mycobacterium tuberculosis rubB (MTCY20B11.25c). Contains rubredoxin signature (PS00202). BELONGS TO THE RUBREDOXIN FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3585171 | 3585338 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3279c|rubA
MAAYRCPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDCAVREKVDFEKIGG
Bibliography
No article yet recorded