Gene Rv3251c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase. |
| Product | Probable rubredoxin RubA |
| Comments | Rv3251c, (MTCY20B11.26c), len: 55 aa. Probable rubA, rubredoxin, highly similar to other rubredoxins (but sometimes shorter) e.g. Q9AE67|RUBA3 from Rhodococcus erythropolis (61 aa), FASTA scores: opt: 335, E(): 1e-17, (73.6% identity in 53 aa overlap); P00272|RUB2_PSEOL|ALKG from Pseudomonas oleovorans (172 aa), FASTA scores: opt: 278, E(): 2.7e-13, (65.3% identity in 49 aa overlap); CAC38028|ALKG from Alcanivorax borkumensis (174 aa), FASTA scores: opt: 271, E(): 8.6e-13, (62.0% identity in 50 aa overlap); Q9WWW4|ALKG from Pseudomonas putida (175 aa), FASTA scores: opt: 270, E(): 1e-12, (61.8% identity in 55 aa overlap); etc. Also highly similar to C-terminus of Q9XBM1|ALKB alkane 1-monooxygenase from Prauserella rugosa (490 aa), FASTA scores: opt: 296, E(): 2.9e-14, (75.5% identity in 49 aa overlap). Also similar to neighbouring ORF Mycobacterium tuberculosis rubB (MTCY20B11.25c). Contains rubredoxin signature (PS00202). Belongs to the rubredoxin family. |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3630571 | 3630738 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3251c|rubA
MAAYRCPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDCAVREKVDFEKIGG
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
