Gene Mb3297
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3297, -, len: 93 aa. Equivalent to Rv3269, len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Conserved hypothetical protein, similar to many Mycobacterium proteins and chaperonins/heat shock proteins e.g. Q9CCL0|ML0748 HYPOTHETICAL PROTEIN from Mycobacterium leprae (92 aa),FASTA scores: opt: 427, E(): 6.8e-21, (73.65% identity in 91 aa overlap); Q10865|Rv1993c|MT2049|MTCY39.26c HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (90 aa), FASTA scores: opt: 313, E(): 1.2e-13, (60.7% identity in 84 aa overlap); P71542|Y968_MYCTU|Rv0968|MTCY10D7.06c (98 aa), FASTA scores: opt: 294, E(): 2.2e-12, (55.1% identity in 98 aa overlap); Q50827|MOPA|GROEL|CH60_MYCVA CHAPERONIN (PROTEIN CPN60) from Mycobacterium vaccae (120 aa), FASTA scores: opt: 107, E(): 2.1, (39.5% identity in 81 aa overlap); Q9AEB3|HSP65 HEAT SHOCK PROTEIN (FRAGMENT) from Mycobacterium gadium (122 aa), FASTA scores: opt: 102, E(): 4.4, (38.25% identity in 81 aa overlap); Q49374|CH60_MYCGN|MOPA|GROEL CHAPERONIN (PROTEIN CPN60) from Mycobacterium genavense (120 aa), FASTA scores: opt: 99, E(): 6.8, (40.25% identity in 82 aa overlap); etc. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3604822 | 3605103 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3297|Mb3297
MAIQVFLAKATTTVITGLAGVTAYEILKKAAAKAPLRQTAVSAAALGLRGTRKAEEAAESARLKVADVMAEARERIGEESPTPAISDLHDHDH
Bibliography
No article yet recorded