Gene Mb3309
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable bifunctional protein acetyl-/propionyl-coenzyme a carboxylase (epsilon chain) acce5 |
Comments | Mb3309, -, len: 156 aa. Similar to Rv3281, len: 177 aa, from Mycobacterium tuberculosis strain H37Rv, (88.1% identity in 177 aa overlap). Conserved hypothetical protein, equivalent (but longer 14 aa and with a gap between aa 82-102) to AAK47723|MT3380 from Mycobacterium tuberculosis strain CDC1551 (142 aa), FASTA scores: opt: 830, E(): 3.1e-40, (86.5% identity in 163 aa overlap). C-terminus highly similar to Q49671|B1308_C3_211|ML0730 from Mycobacterium leprae (84 aa), FASTA scores: opt: 393,E(): 7.6e-16, (68.95% identity in 87 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, an in-frame deletion of 63 bp leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (156 aa versus 177 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3618277 | 3618747 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3309|acce5 MGTCPCESSERNEPVSRVSGTNEVSDGNETNNPAEVSDGNETNNPAEVSDGNETNNPAPVSRVSGTNEVSDGNETNNPAPVTEKPLHPHEPHIEILRGQPTDQELAALIAVLGSISGSTPPAQPEPTRWGLPVDQLRYPVFSWQRITLQEMTHMRR
Bibliography
No article yet recorded