Gene Mb3339
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3339, -, len: 420 aa. Equivalent to Rv3311, len: 420 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 420 aa overlap). Conserved hypothetical protein, equivalent to Mycobacterium leprae hypothetical proteins Q9CCL8|ML0703 (423 aa), FASTA scores: opt: 2185, E(): 5.5e-120, (77.55% identity in 423 aa overlap); Q49918|L308_F2_61 (167 aa), FASTA scores: opt: 929, E(): 3.5e-47, (84.4% identity in 167 aa overlap) (similarity at C-terminus for this one); and Q49914|L308_F1_17 (166 aa), FASTA scores: opt: 900, E(): 1.7e-45, (79.0% identity in 162 aa overlap) (similarity at N-terminus for this one); Q49923|U0308N (86 aa) FASTA scores: opt: 149, E(): 0.052, (48.35% identity in 60 aa overlap); etc. Note that the Rv3311 corresponding protein in Mycobacterium leprae is similar to products of two adjacent ORFs. Also some similarity to Q9XI61|F9L1.1 HYPOTHETICAL PROTEIN from Arabidopsis thaliana (Mouse-ear cress) (523 aa), FASTA scores: opt: 134, E(): 1.8, (25.1% identity in 203 aa overlap). Equivalent to AAK47753 from Mycobacterium tuberculosis strain CDC1551 (431 aa) but shorter 12 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3652646 | 3653908 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3339|Mb3339
MVADLVPIRLSLSAGDRYTLWAPRWRDAGDEWEAFLGKDDDLYGFESVSDLVAFVRTDTENDLVDHPAWQDLTGAHAHNLNPAEDNQFDLVVVEELLAEKPTAESVAALAASLAIVSAIGSVCELAAVSKFFNGNPILGTVSGGLEHFTGKAGNKRWNSIAEVIGRSWDDVLAAIDEIISTPEVDAELSEKVAEELAEEPEGAEEVAAEVEATQDTQEAAESDDEEADAPGDSVVLGGDRDFWLQVGIDPIQIMTGTATFYTLRCYLDDRPIFLGRNGRISVFGSERALARYLADEHDHDLSDLSTYDDIRTAATDGSLAVAVTDDNVYVLSGLVDDFADGPDAVDREQLDLAVELLRDIGDYSEDSAVDKALETTRPLGQLVAYVLDPHSVGKPTAPYAAAVREWEKLERFVESRLRRE
Bibliography
No article yet recorded