Gene Rv3311
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3311, (MTV016.10), len: 420 aa. Conserved protein, equivalent to Mycobacterium leprae hypothetical proteins Q9CCL8|ML0703 (423 aa), FASTA scores: opt: 2185, E(): 5.5e-120, (77.55% identity in 423 aa overlap); Q49918|L308_F2_61 (167 aa), FASTA scores: opt: 929, E(): 3.5e-47, (84.4% identity in 167 aa overlap) (similarity at C-terminus for this one); and Q49914|L308_F1_17 (166 aa), FASTA scores: opt: 900, E(): 1.7e-45, (79.0% identity in 162 aa overlap) (similarity at N-terminus for this one); Q49923|U0308N (86 aa) FASTA scores: opt: 149, E(): 0.052, (48.35% identity in 60 aa overlap); etc. Note that the Rv3311 corresponding protein in Mycobacterium leprae is similar to products of two adjacent ORFs. Also some similarity to Q9XI61|F9L1.1 hypothetical protein from Arabidopsis thaliana (Mouse-ear cress) (523 aa), FASTA scores: opt: 134, E(): 1.8, (25.1% identity in 203 aa overlap). Equivalent to AAK47753 from Mycobacterium tuberculosis strain CDC1551 (431 aa) but shorter 12 aa. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3698121 | 3699383 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3311|Rv3311
MVADLVPIRLSLSAGDRYTLWAPRWRDAGDEWEAFLGKDDDLYGFESVSDLVAFVRTDTENDLVDHPAWQDLTGAHAHNLNPAEDNQFDLVVVEELLAEKPTAESVAALAASLAIVSAIGSVCELAAVSKFFNGNPILGTVSGGLEHFTGKAGNKRWNSIAEVIGRSWDDVLAAIDEIISTPEVDAELSEKVAEELAEEPEGAEEVAAEVEATQDTQEAAESDDEEADAPGDSVVLGGDRDFWLQVGIDPIQIMTGTATFYTLRCYLDDRPIFLGRNGRISVFGSERALARYLADEHDHDLSDLSTYDDIRTAATDGSLAVAVTDDNVYVLSGLVDDFADGPDAVDREQLDLAVELLRDIGDYSEDSAVDKALETTRPLGQLVAYVLDPHSVGKPTAPYAAAVREWEKLERFVESRLRRE
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
