Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productprobable penicillin-binding protein dacb1 (d-alanyl-d-alanine carboxypeptidase) (dd-peptidase) (dd-carboxypeptidase) (pbp) (dd-transpeptidase) (serine-type d-ala-d-ala carboxypeptidase) (d-amino acid hydrolase)
CommentsMb3363, dacB1, len: 405 aa. Equivalent to Rv3330,len: 405 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 405 aa overlap). Probable dacB1,D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein) (EC 3.4.16.4), equivalent to Mycobacterium leprae proteins Q9CCM2|ML0691 PUTATIVE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE (411 aa), FASTA scores: opt: 2066, E(): 2.5e-102, (77.15% identity in 416 aa overlap); Q49917|L308_F1_36 (228 aa), FASTA scores: opt: 1241, E(): 7.9e-59, (78.9% identity in 232 aa overlap) (note that this protein corresponds to C-terminal part of the putative protein encoded by Rv3330, aa 174-405); and Q49921|PBPC (182 aa), FASTA scores: opt: 736, E(): 3.7e-32, (73.95% identity in 169 aa overlap) (note that this protein corresponds to N-terminal part of the putative protein encoded by Rv3330, aa 1-158); note L308_F1_36 (228 aa) and PBPC (182 aa) are two consecutive Mycobacterium leprae ORFs . Also similar to others e.g. Q9FC34|SC4G1.16c PUTATIVE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE from Streptomyces coelicolor (413 aa),FASTA scores: opt: 572, E(): 3.4e-23, (33.75% identity in 382 aa overlap); P35150|DACB_BACSU PENICILLIN-BINDING PROTEIN 5* PRECURSOR (D-ALANYL-D-ALANINE CARBOXYPEPTIDASE) from Bacillus subtilis (382 aa), FASTA scores: opt: 422,E(): 2.8e-15, (31.3% identity in 249 aa overlap); Q9K8X5|DACB|BH2877 D-ALANYL-D-ALANINE CARBOXYPEPTIDASE (PENICILLIN-BINDING PROTEIN) from Bacillus halodurans (395 aa), FASTA scores: opt: 421, E(): 3.2e-15, (31.95% identity in 241 aa overlap); etc. Also similar to M. tuberculosis Q10828|Rv2911|MTCY274.43 PROBABLE PENICILLIN-BINDING PROTEIN (BELONGS TO PEPTIDASE FAMILY S11; ALSO KNOWN AS THE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE 1 FAMILY) (291 aa), FASTA scores: opt: 746, E(): 1.6e-32,(47.0% identity in 266 aa overlap). Has hydrophobic stretches at both N- and C-termini. Certainly membrane-bound protein. BELONGS TO PEPTIDASE FAMILY S11; ALSO KNOWN AS THE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE 1 FAMILY.
Functional category
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36730263674243+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3363|dacB1
MAFLRSVSCLAAAVFAVGTGIGLPTAAGEPNAAPAACPYKVSTPPAVDSSEVPAAGEPPLPLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPASVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQNPVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRDGRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRNPADRQRVDPQAAARISAADALPVRVGVAVIGALIVFGLIMVARAMNRRPQH
      
Bibliography
No article yet recorded