Gene Rv3330
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in peptidoglycan synthesis (at final stages). Hydrolyzes the bound D-alanyl-D-alanine [catalytic activity: D-alanyl-D-alanine + H(2)O = 2 D-alanine]. |
| Product | Probable penicillin-binding protein DacB1 (D-alanyl-D-alanine carboxypeptidase) (DD-peptidase) (DD-carboxypeptidase) (PBP) (DD-transpeptidase) (serine-type D-ala-D-ala carboxypeptidase) (D-amino acid hydrolase) |
| Comments | Rv3330, (MTV016.30), len: 405 aa. Probable dacB1, D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein), equivalent to Mycobacterium leprae proteins Q9CCM2|ML0691 putative D-alanyl-D-alanine carboxypeptidase (411 aa), FASTA scores: opt: 2066, E(): 2.5e-102, (77.15% identity in 416 aa overlap); Q49917|L308_F1_36 (228 aa), FASTA scores: opt: 1241, E(): 7.9e-59, (78.9% identity in 232 aa overlap) (note that this protein corresponds to C-terminal part of the putative protein encoded by Rv3330, aa 174-405); and Q49921|PBPC (182 aa), FASTA scores: opt: 736, E(): 3.7e-32, (73.95% identity in 169 aa overlap) (note that this protein corresponds to N-terminal part of the putative protein encoded by Rv3330, aa 1-158); note L308_F1_36 (228 aa) and PBPC (182 aa) are two consecutive Mycobacterium leprae ORFs. Also similar to others e.g. Q9FC34|SC4G1.16c putative D-alanyl-D-alanine carboxypeptidase from Streptomyces coelicolor (413 aa), FASTA scores: opt: 572, E(): 3.4e-23, (33.75% identity in 382 aa overlap); P35150|DACB_BACSU penicillin-binding protein 5* precursor (D-alanyl-D-alanine carboxypeptidase) from Bacillus subtilis (382 aa), FASTA scores: opt: 422, E(): 2.8e-15, (31.3% identity in 249 aa overlap); Q9K8X5|DACB|BH2877 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein) from Bacillus halodurans (395 aa), FASTA scores: opt: 421, E(): 3.2e-15, (31.95% identity in 241 aa overlap); etc. Also similar to Mycobacterium tuberculosis Q10828|Rv2911|MTCY274.43 probable penicillin-binding protein (belongs to peptidase family S11; also known as the D-alanyl-D-alanine carboxypeptidase 1 family) (291 aa), FASTA scores: opt: 746, E(): 1.6e-32, (47.0% identity in 266 aa overlap). Has hydrophobic stretches at both N- and C-termini. Certainly membrane-bound protein. Belongs to peptidase family S11; also known as the D-alanyl-D-alanine carboxypeptidase 1 family. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3715777 | 3716994 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3330|dacB1
MAFLRSVSCLAAAVFAVGTGIGLPTAAGEPNAAPAACPYKVSTPPAVDSSEVPAAGEPPLPLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPASVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQNPVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRDGRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRNPADRQRVDPQAAARISAADALPVRVGVAVIGALIVFGLIMVARAMNRRPQH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Ribeiro-GuimarĂ£es ML et al. [2007]. Comparative genomics of mycobacterial proteases. Homology
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant