Gene Mb3378c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved transmembrane protein |
Comments | Mb3378c, -, len: 85 aa. Equivalent to Rv3346c, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 85 aa overlap). Conserved hypothetical protein, highly similar to mycobacterium hypothetical proteins O50384|Rv3355c|MTV004.12c from strain H37Rv (97 aa), FASTA scores: opt: 413, E(): 4.6e-23, (85.55% identity in 97 aa overlap); O32878|MLCB1779.16c|ML0675 from Mycobacterium leprae (91 aa), FASTA scores: opt: 349,E(): 1.7e-18, (67.35% identity in 95 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3696732 | 3696989 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3378c|Mb3378c MTVRAVLRRTVGAQWPILAGVNFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
Bibliography
No article yet recorded