Gene Rv3346c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved transmembrane protein |
| Comments | Rv3346c, (MTV004.02c), len: 85 aa. Conserved transmembrane protein, highly similar to mycobacterium hypothetical proteins O50384|Rv3355c|MTV004.12c from strain H37Rv (97 aa), FASTA scores: opt: 413, E(): 4.6e-23, (85.55% identity in 97 aa overlap); O32878|MLCB1779.16c|ML0675 from Mycobacterium leprae (91 aa), FASTA scores: opt: 349, E(): 1.7e-18, (67.35% identity in 95 aa overlap). Contains possible membrane spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3743198 | 3743455 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3346c|Rv3346c
MTVRAVLRRTVGAQWPILAGVNFWRRGALLIGIGVGVAAVLRLVLSEERAGLLVVRSKGIDFVTTVTVAAAMVYIASTIDPLGTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant