Gene Mb3387c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE OXIDOREDUCTASE |
| Comments | Mb3387c, -, len: 123 aa. Equivalent to Rv3352c,len: 123 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 123 aa overlap). Possible oxidoreductase (EC 1.-.-.-), similar to part of several oxidoreductases (and hypothetical proteins) from diverse organisms e.g. Q9KYD6|SCD72A.20 PUTATIVE LIPOPROTEIN (FRAGMENT) from Streptomyces coelicolor (403 aa), FASTA scores: opt: 348, E(): 7.9e-15, (51.0% identity in 102 aa overlap); BAB53081|MLR6875 PROBABLE OXIDOREDUCTASE from Rhizobium loti (Mesorhizobium loti) (479 aa), FASTA scores: opt: 262, E(): 2.3e-09, (53.85% identity in 78 aa overlap); O94206|OX1 OXIDOREDUCTASE from Claviceps purpurea (Ergot fungus) (483 aa), FASTA scores: opt: 245,E(): 2.7e-08, (42.6% identity in 115 aa overlap); Q9KHK2|ENCM PUTATIVE FAD-DEPENDENT OXYGENASE ENCM from Streptomyces maritimus (464 aa), FASTA scores: opt: 238,E(): 7.2e-08, (43.95% identity in 91 aa overlap); etc. Also highly similar to part of O53608|Rv0063|MTV030.06 OXIDOREDUCTASE (479 aa), FASTA scores: opt: 599, E(): 1.6e-30, (71.55% identity in 123 aa overlap); and to other Mycobacterium tuberculosis proteins e.g. Rv3353c and Rv3351c. All show similarity to a family of oxidoreductases in M. tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3721748 | 3722119 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3387c|Mb3387c
MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG
Bibliography
No article yet recorded
