Gene Rv3352c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv3352c, (MTV004.09c), len: 123 aa. Possible oxidoreductase, similar to part of several oxidoreductases (and hypothetical proteins) from diverse organisms e.g. Q9KYD6|SCD72A.20 putative lipoprotein (fragment) from Streptomyces coelicolor (403 aa), FASTA scores: opt: 348, E(): 7.9e-15, (51.0% identity in 102 aa overlap); BAB53081|MLR6875 probable oxidoreductase from Rhizobium loti (Mesorhizobium loti) (479 aa), FASTA scores: opt: 262, E(): 2.3e-09, (53.85% identity in 78 aa overlap); O94206|OX1 oxidoreductase from Claviceps purpurea (Ergot fungus) (483 aa), FASTA scores: opt: 245, E(): 2.7e-08, (42.6% identity in 115 aa overlap); Q9KHK2|ENCM putative FAD-dependent oxygenase ENCM from Streptomyces maritimus (464 aa), FASTA scores: opt: 238, E(): 7.2e-08, (43.95% identity in 91 aa overlap); etc. Also highly similar to part of O53608|Rv0063|MTV030.06 oxidoreductase (479 aa), FASTA scores: opt: 599, E(): 1.6e-30, (71.55% identity in 123 aa overlap); and to other Mycobacterium tuberculosis proteins e.g. Rv3353c and Rv3351c. All show similarity to a family of oxidoreductases in Mycobacterium tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3768222 | 3768593 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3352c|Rv3352c
VSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
