Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible oxidoreductase
CommentsRv3352c, (MTV004.09c), len: 123 aa. Possible oxidoreductase, similar to part of several oxidoreductases (and hypothetical proteins) from diverse organisms e.g. Q9KYD6|SCD72A.20 putative lipoprotein (fragment) from Streptomyces coelicolor (403 aa), FASTA scores: opt: 348, E(): 7.9e-15, (51.0% identity in 102 aa overlap); BAB53081|MLR6875 probable oxidoreductase from Rhizobium loti (Mesorhizobium loti) (479 aa), FASTA scores: opt: 262, E(): 2.3e-09, (53.85% identity in 78 aa overlap); O94206|OX1 oxidoreductase from Claviceps purpurea (Ergot fungus) (483 aa), FASTA scores: opt: 245, E(): 2.7e-08, (42.6% identity in 115 aa overlap); Q9KHK2|ENCM putative FAD-dependent oxygenase ENCM from Streptomyces maritimus (464 aa), FASTA scores: opt: 238, E(): 7.2e-08, (43.95% identity in 91 aa overlap); etc. Also highly similar to part of O53608|Rv0063|MTV030.06 oxidoreductase (479 aa), FASTA scores: opt: 599, E(): 1.6e-30, (71.55% identity in 123 aa overlap); and to other Mycobacterium tuberculosis proteins e.g. Rv3353c and Rv3351c. All show similarity to a family of oxidoreductases in Mycobacterium tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found.
Functional categoryIntermediary metabolism and respiration
MutantDisruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37682223768593-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3352c|Rv3352c
VSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG