Gene Mb3388c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3388c, -, len: 86 aa. Equivalent to Rv3353c, len: 86 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 86 aa overlap). Hypothetical protein,showing some similarity to Q9X5Q4|MITR MITR PROTEIN from Streptomyces lavendulae (514 aa), FASTA scores: opt: 134,E(): 0.09, (29.5% identity in 78 aa overlap); and weak to Q49720|B1549_C3_218 from Mycobacterium leprae (222 aa),FASTA scores: opt: 99, E(): 8.8, (32.9% identity in 76 aa overlap). But highly similar to N-terminal part of O53608|Rv0063|MTV030.06 OXIDOREDUCTASE from M. tuberculosis (479 aa), FASTA scores: opt: 305, E(): 4.9e-13, (52.9% identity in 87 aa overlap); and some similarity can be found with Rv3352c and Rv3351c. All show similarity to a family of oxidoreductases in M. tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found. Start changed since original submission. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3722262 | 3722522 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3388c|Mb3388c
MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS
Bibliography
No article yet recorded