Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3353c, (MTV004.10c), len: 86 aa. Hypothetical protein, showing some similarity to Q9X5Q4|MITR MITR protein from Streptomyces lavendulae (514 aa), FASTA scores: opt: 134, E(): 0.09, (29.5% identity in 78 aa overlap); and weak to Q49720|B1549_C3_218 from Mycobacterium leprae (222 aa), FASTA scores: opt: 99, E(): 8.8, (32.9% identity in 76 aa overlap). But highly similar to N-terminal part of O53608|Rv0063|MTV030.06 oxidoreductase from Mycobacterium tuberculosis (479 aa), FASTA scores: opt: 305, E(): 4.9e-13, (52.9% identity in 87 aa overlap); and some similarity can be found with Rv3352c and Rv3351c. All show similarity to a family of oxidoreductases in Mycobacterium tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found. Start changed since original submission.
Functional categoryConserved hypotheticals
MutantDisruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37687363768996-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3353c|Rv3353c
MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS