Gene Rv3353c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3353c, (MTV004.10c), len: 86 aa. Hypothetical protein, showing some similarity to Q9X5Q4|MITR MITR protein from Streptomyces lavendulae (514 aa), FASTA scores: opt: 134, E(): 0.09, (29.5% identity in 78 aa overlap); and weak to Q49720|B1549_C3_218 from Mycobacterium leprae (222 aa), FASTA scores: opt: 99, E(): 8.8, (32.9% identity in 76 aa overlap). But highly similar to N-terminal part of O53608|Rv0063|MTV030.06 oxidoreductase from Mycobacterium tuberculosis (479 aa), FASTA scores: opt: 305, E(): 4.9e-13, (52.9% identity in 87 aa overlap); and some similarity can be found with Rv3352c and Rv3351c. All show similarity to a family of oxidoreductases in Mycobacterium tuberculosis, suggesting that frameshift mutations may have occurred. Sequence has been checked but no errors were found. Start changed since original submission. |
| Functional category | Conserved hypotheticals |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3768736 | 3768996 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3353c|Rv3353c
MSRQTFLRGAVGAPATSAVFPTILARATPGDGWASLASSIGGQVLLPANGRAFTSGKQIFNSNYSGLNPAAVVTVASQADVRKAVS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
