Gene Mb3395
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3395, -, len: 122 aa. Equivalent to Rv3360, len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 122 aa overlap). Hypothetical protein,highly similar to the N-terminus of O65934|Rv1747|MTCY28.10|MTCY04C12.31 probable ABC-transporter ATP-binding protein from Mycobacterium tuberculosis (865 aa), FASTA scores: opt: 480, E(): 4.7e-25, (61.0% identity in 118 aa overlap); and some similarity with the N-terminus of P96214|Rv3863|MTCY01A6.05c HYPOTHETICAL 41.1 KDA PROTEIN from Mycobacterium tuberculosis (392 aa), FASTA scores: opt: 138, E(): 0.033, (31.95% identity in 97 aa overlap). Some weak similarity with the N-terminus of other hypothetical proteins e.g. P73823|CYAA|SLR1991 ADENYLATE CYCLASE from Synechocystis sp. strain PCC 6803 (337 aa),FASTA scores: opt: 127, E(): 0.16, (28.55% identity in 112 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3726177 | 3726545 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3395|Mb3395
MSRPHPPVLTVRSDRSQQCFAAGRDVVVGSDLRADMRVAHPLIARAHLLLRFDRGNWIAIDNDSQSGMFVDGQRVSEVDIYDGLTINIGKPTGPWITFEVGHHQGIIGRLSRTPSSRPGSPI
Bibliography
No article yet recorded