Gene Rv3360
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3360, (MTV004.17), len: 122 aa. Hypothetical protein, highly similar to the N-terminus of O65934|Rv1747|MTCY28.10|MTCY04C12.31 probable ABC-transporter ATP-binding protein from Mycobacterium tuberculosis (865 aa), FASTA scores: opt: 480, E(): 4.7e-25, (61.0% identity in 118 aa overlap); and some similarity with the N-terminus of P96214|Rv3863|MTCY01A6.05c hypothetical 41.1 KDA protein from Mycobacterium tuberculosis (392 aa), FASTA scores: opt: 138, E(): 0.033, (31.95% identity in 97 aa overlap). Some weak similarity with the N-terminus of other hypothetical proteins e.g. P73823|CYAA|SLR1991 adenylate cyclase from Synechocystis sp. strain PCC 6803 (337 aa), FASTA scores: opt: 127, E(): 0.16, (28.55% identity in 112 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3772651 | 3773019 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3360|Rv3360
MSRPHPPVLTVRSDRSQQCFAAGRDVVVGSDLRADMRVAHPLIARAHLLLRFDRGNWIAIDNDSQSGMFVDGQRVSEVDIYDGLTINIGKPTGPWITFEVGHHQGIIGRLSRTPSSRPGSPI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
