Gene Mb3401
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE tRNA/rRNA METHYLASE SPOU (tRNA/rRNA METHYLTRANSFERASE) |
| Comments | Mb3401, spoU, len: 154 aa. Equivalent to Rv3366,len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 154 aa overlap). Probable spoU,tRNA/rRNA methylase (EC 2.1.1.-), equivalent to Q9CCU7|ML0419 PUTATIVE tRNA/rRNA METHYLTRANSFERASE from Mycobacterium leprae (158 aa), FASTA scores: opt: 861,E(): 1.2e-50, (83.75% identity in 154 aa overlap); and O07698|MLCL383.24c rRNA METHYLASE from Mycobacterium leprae (169 aa), FASTA scores: opt: 861, E(): 1.3e-50,(83.75% identity in 154 aa overlap). Also highly similar to many members of the spoU family of rRNA methylases e.g. Q9K199|NMB0268 RNA METHYLTRANSFERASE (TRMH FAMILY) from Neisseria meningitidis (serogroup B) (154 aa), FASTA scores: opt: 534, E(): 7.6e-29, (50.0% identity in 154 aa overlap); and Q9JSM8|NMA2218 from Neisseria meningitidis (serogroup A) (154 aa), FASTA scores: opt: 526, E(): 2.6e-28, (49.35% identity in 154 aa overlap); Q9HU57|PA5127 from Pseudomonas aeruginosa (153 aa), FASTA scores: opt: 531, E(): 1.2e-28, (52.95% identity in 151 aa overlap); P33899|YIBK_ECOLI|B3606 from Escherichia coli strain K12 (157 aa), FASTA scores: opt: 511, E(): 2.6e-27,(49.35% identity in 154 aa overlap); etc. BELONGS TO THE RNA METHYLTRANSFERASE TRMH FAMILY. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3731263 | 3731727 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3401|spoU
MFRLLFVSPRIAPNTGNAIRTCAATGCELHLVEPLGFDLSEPKLRRAGLDYHDLASVTVHASLAHAWEALSPARVFAFTAQATTLFTNVGYRAGDVLMFGPEPTGLDEATLADTHITGQVRIPMLAGRRSLNLSNAAAVAVYEAWRQHGFAGAV
Bibliography
No article yet recorded
