Gene Rv3366
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Causes methylation |
| Product | Probable tRNA/rRNA methylase SpoU (tRNA/rRNA methyltransferase) |
| Comments | Rv3366, (MTV004.23), len: 154 aa. Probable spoU, tRNA/rRNA methylase, equivalent to Q9CCU7|ML0419 putative tRNA/rRNA methyltransferase from Mycobacterium leprae (158 aa), FASTA scores: opt: 861, E(): 1.2e-50, (83.75% identity in 154 aa overlap); and O07698|MLCL383.24c rRNA methylase from Mycobacterium leprae (169 aa), FASTA scores: opt: 861, E(): 1.3e-50, (83.75% identity in 154 aa overlap). Also highly similar to many members of the spoU family of rRNA methylases e.g. Q9K199|NMB0268 RNA methyltransferase (TRMH family) from Neisseria meningitidis (serogroup B) (154 aa), FASTA scores: opt: 534, E(): 7.6e-29, (50.0% identity in 154 aa overlap); and Q9JSM8|NMA2218 from Neisseria meningitidis (serogroup A) (154 aa), FASTA scores: opt: 526, E(): 2.6e-28, (49.35% identity in 154 aa overlap); Q9HU57|PA5127 from Pseudomonas aeruginosa (153 aa), FASTA scores: opt: 531, E(): 1.2e-28, (52.95% identity in 151 aa overlap); P33899|YIBK_ECOLI|B3606 from Escherichia coli strain K12 (157 aa), FASTA scores: opt: 511, E(): 2.6e-27, (49.35% identity in 154 aa overlap); etc. Belongs to the RNA methyltransferase TrmH family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3777737 | 3778201 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3366|spoU
MFRLLFVSPRIAPNTGNAIRTCAATGCELHLVEPLGFDLSEPKLRRAGLDYHDLASVTVHASLAHAWEALSPARVFAFTAQATTLFTNVGYRAGDVLMFGPEPTGLDEATLADTHITGQVRIPMLAGRRSLNLSNAAAVAVYEAWRQHGFAGAV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant