Gene Mb3404 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein | 
| Comments | Mb3404, -, len: 144 aa. Equivalent to Rv3369, len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 144 aa overlap). Conserved hypothetical protein. C-terminus is similar to N-terminus of O07696|MLCL383.22c HYPOTHETICAL 14.7 KDA PROTEIN from Mycobacterium leprae (131 aa), FASTA scores: opt: 174,E(): 6e-05, (67.55% identity in 37 aa overlap). Also some slight similarity to Q9EWU1|3SC5B7.08c from Streptomyces coelicolor (153 aa), FASTA scores: opt: 125, E(): 0.13,(31.05% identity in 116 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3734618 | 3735052 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb3404|Mb3404
MWAGYRWAMSVELTQEVSARLTSDLYGWLTTVARSGQPVPRLVWFYFDGTDLTVYSMPQAAKVAHITAHPQVSLNLDSDGNGAGIIVVGGTAAVVATDVDCRDDAPYWAKYREDAAKFGLTEAIAAYSTRLKITPTRVWTTPTG
      
    Bibliography
    No article yet recorded