Gene Mb3404
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3404, -, len: 144 aa. Equivalent to Rv3369, len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 144 aa overlap). Conserved hypothetical protein. C-terminus is similar to N-terminus of O07696|MLCL383.22c HYPOTHETICAL 14.7 KDA PROTEIN from Mycobacterium leprae (131 aa), FASTA scores: opt: 174,E(): 6e-05, (67.55% identity in 37 aa overlap). Also some slight similarity to Q9EWU1|3SC5B7.08c from Streptomyces coelicolor (153 aa), FASTA scores: opt: 125, E(): 0.13,(31.05% identity in 116 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3734618 | 3735052 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3404|Mb3404
MWAGYRWAMSVELTQEVSARLTSDLYGWLTTVARSGQPVPRLVWFYFDGTDLTVYSMPQAAKVAHITAHPQVSLNLDSDGNGAGIIVVGGTAAVVATDVDCRDDAPYWAKYREDAAKFGLTEAIAAYSTRLKITPTRVWTTPTG
Bibliography
No article yet recorded