Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3369, (MTV004.27), len: 144 aa. Conserved protein. C-terminus is similar to N-terminus of O07696|MLCL383.22c hypothetical 14.7 KDA protein from Mycobacterium leprae (131 aa), FASTA scores: opt: 174, E(): 6e-05, (67.55% identity in 37 aa overlap). Also some slight similarity to Q9EWU1|3SC5B7.08c from Streptomyces coelicolor (153 aa), FASTA scores: opt: 125, E(): 0.13, (31.05% identity in 116 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37809783781412+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3369|Rv3369
MWAGYRWAMSVELTQEVSARLTSDLYGWLTTVARSGQPVPRLVWFYFDGTDLTVYSMPQAAKVAHITAHPQVSLNLDSDGNGAGIIVVGGTAAVVATDVDCRDDAPYWAKYREDAAKFGLTEAIAAYSTRLKITPTRVWTTPTG