Gene Mb3450
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein whib-like whib3. contains [4fe-4s] cluster. |
| Comments | Mb3450, whiB3, len: 102 aa. Equivalent to Rv3416,len: 102 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 102 aa overlap). whiB3 (alternate gene name: whmB), WhiB-like regulatory protein (see citations below), similar to WhiB paralogue of Streptomyces coelicolor, wblE gene product (85 aa). Equivalent to Q49871|WHIB3|WHIB|ML0382|B229_F1_2|B1620_F3_137 PROBABLE TRANSCRIPTION FACTOR WHIB3 from Mycobacterium leprae (102 aa), FASTA scores: opt: 657, E(): 7.9e-39, (86.25% identity in 102 aa overlap). Also highly similar to Q9Z6E9|WHIB3 from Mycobacterium smegmatis (96 aa), FASTA scores: opt: 604, E(): 3.5e-35, (80.4% identity in 102 aa overlap); and O88103|WHID|SC6G4.45c|WBLB from Streptomyces coelicolor (112 aa), FASTA scores: opt: 437, E(): 1.4e-23,(62.5% identity in 96 aa overlap). Also similar to O05847|WHIB1|Rv3219|MTCY07D11.07c from Mycobacterium tuberculosis (84 aa), FASTA scores: opt: 215, E(): 2.5e-08, (44.45% identity in 81 aa overlap). Note that primer extension analysis revealed three transcriptional start sites and that expression from the three potential promoters is growth phase-dependent (see third citation). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3787520 | 3787828 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3450|whiB3
MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRRTA
Bibliography
No article yet recorded