Gene Mb3454c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ribosomal-protein-alanine acetyltransferase rimi (acetylating enzyme for n-terminal of ribosomal protein s18) |
| Comments | Mb3454c, rimI, len: 158 aa. Equivalent to Rv3420c,len: 158 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 158 aa overlap). Probable rimI,ribosomal-protein-alanine acetyltransferase (EC 2.3.1.128), equivalent to C-terminal part of Q49857|YY21_MYCLE|ML0378|B229_C1_170 HYPOTHETICAL 38.0 KDA PROTEIN from Mycobacterium leprae (359 aa), FASTA scores: opt: 772, E(): 2.7e-44, (72.1% identity in 154 aa overlap). Similar notably to ribosomal-protein-alanine acetyltransferases e.g. Q9AC11|CC0058 from Caulobacter crescentus (150 aa), FASTA scores: opt: 223, E(): 4.9e-08,(37.5% identity in 136 aa overlap); Q9KFD4|BH0547 from Bacillus halodurans (151 aa), FASTA scores: opt: 222, E(): 5.8e-08, (35.2% identity in 142 aa overlap); Q9PG61|XF0441 from Xylella fastidiosa (156 aa), FASTA scores: opt: 207,E(): 5.9e-07, (32.2% identity in 149 aa overlap); Q9HVB7|RIMI|PA4678 from Pseudomonas aeruginosa (150 aa),FASTA scores: opt: 203, E(): 1.1e-06, (32.45% identity in 151 aa overlap); P09453|RIMI_ECOLI|B4373 from Escherichia coli strain K12 (148 aa), FASTA scores: opt: 196, E(): 3.1e-06, (33.55% identity in 149 aa overlap); etc. BELONGS TO THE ACETYLTRANSFERASE FAMILY, RIMI SUBFAMILY. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3791214 | 3791690 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3454c|rimI
MTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS
Bibliography
No article yet recorded