Gene Rv3420c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylates the N-terminal alanine of ribosomal protein S18 [catalytic activity: acetyl-CoA + ribosomal-protein L-alanine = CoA + ribosomal-protein N-acetyl-L-alanine]. |
| Product | Ribosomal-protein-alanine acetyltransferase RimI (acetylating enzyme for N-terminal of ribosomal protein S18) |
| Comments | Rv3420c, (MTCY78.09), len: 158 aa. Probable rimI, ribosomal-protein-alanine acetyltransferase, contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Equivalent to C-terminal part of Q49857|YY21_MYCLE|ML0378|B229_C1_170 hypothetical 38.0 KDA protein from Mycobacterium leprae (359 aa), FASTA scores: opt: 772, E(): 2.7e-44, (72.1% identity in 154 aa overlap). Similar notably to ribosomal-protein-alanine acetyltransferases e.g. Q9AC11|CC0058 from Caulobacter crescentus (150 aa), FASTA scores: opt: 223, E(): 4.9e-08, (37.5% identity in 136 aa overlap); Q9KFD4|BH0547 from Bacillus halodurans (151 aa), FASTA scores: opt: 222, E(): 5.8e-08, (35.2% identity in 142 aa overlap); Q9PG61|XF0441 from Xylella fastidiosa (156 aa), FASTA scores: opt: 207, E(): 5.9e-07, (32.2% identity in 149 aa overlap); Q9HVB7|RIMI|PA4678 from Pseudomonas aeruginosa (150 aa), FASTA scores: opt: 203, E(): 1.1e-06, (32.45% identity in 151 aa overlap); P09453|RIMI_ECOLI|B4373 from Escherichia coli strain K12 (148 aa), FASTA scores: opt: 196, E(): 3.1e-06, (33.55% identity in 149 aa overlap); etc. Belongs to the acetyltransferase family, RIMI subfamily. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3838586 | 3839062 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3420c|rimI
VTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant