Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionAcetylates the N-terminal alanine of ribosomal protein S18 [catalytic activity: acetyl-CoA + ribosomal-protein L-alanine = CoA + ribosomal-protein N-acetyl-L-alanine].
ProductRibosomal-protein-alanine acetyltransferase RimI (acetylating enzyme for N-terminal of ribosomal protein S18)
CommentsRv3420c, (MTCY78.09), len: 158 aa. Probable rimI, ribosomal-protein-alanine acetyltransferase, contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Equivalent to C-terminal part of Q49857|YY21_MYCLE|ML0378|B229_C1_170 hypothetical 38.0 KDA protein from Mycobacterium leprae (359 aa), FASTA scores: opt: 772, E(): 2.7e-44, (72.1% identity in 154 aa overlap). Similar notably to ribosomal-protein-alanine acetyltransferases e.g. Q9AC11|CC0058 from Caulobacter crescentus (150 aa), FASTA scores: opt: 223, E(): 4.9e-08, (37.5% identity in 136 aa overlap); Q9KFD4|BH0547 from Bacillus halodurans (151 aa), FASTA scores: opt: 222, E(): 5.8e-08, (35.2% identity in 142 aa overlap); Q9PG61|XF0441 from Xylella fastidiosa (156 aa), FASTA scores: opt: 207, E(): 5.9e-07, (32.2% identity in 149 aa overlap); Q9HVB7|RIMI|PA4678 from Pseudomonas aeruginosa (150 aa), FASTA scores: opt: 203, E(): 1.1e-06, (32.45% identity in 151 aa overlap); P09453|RIMI_ECOLI|B4373 from Escherichia coli strain K12 (148 aa), FASTA scores: opt: 196, E(): 3.1e-06, (33.55% identity in 149 aa overlap); etc. Belongs to the acetyltransferase family, RIMI subfamily.
Functional categoryInformation pathways
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38385863839062-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3420c|rimI
VTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS