Gene Mb3455c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3455c, -, len: 211 aa. Equivalent to Rv3421c,len: 211 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 211 aa overlap). Conserved hypothetical protein, equivalent to Q49857|YY21_MYCLE|ML0378|B229_C1_170 HYPOTHETICAL 38.0 KDA PROTEIN from Mycobacterium leprae (359 aa), FASTA scores: opt: 1000, E(): 1.8e-50, (75.6% identity in 205 aa overlap). Also similar to other hypothetical bacterial proteins e.g. O86791|SC6G4.28 from Streptomyces coelicolor (217 aa), FASTA scores: opt: 453, E(): 3.3e-19, (48.1% identity in 212 aa overlap); Q9AC10|CC0059 (GLYCOPROTEASE FAMILY PROTEIN) from Caulobacter crescentus (211 aa),FASTA scores: opt: 248, E(): 2e-07, (34.3% identity in 210 aa overlap); Q9KQK9|VC1989 from Vibrio cholerae (237 aa),FASTA scores: opt: 238, E(): 8.2e-07, (28.85% identity in 208 aa overlap); BAB51966|Mlr5530 from Rhizobium loti (Mesorhizobium loti) (225 aa), FASTA scores: opt: 237,E(): 9e-07, (35.0% identity in 220 aa overlap); etc. Some similarity to upstream Q50709|GCP_MYCTU|Rv3419c|MT3528|MTCY78.10 from M. tuberculosis (344 aa), (33.9% identity in 127 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3791687 | 3792322 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3455c|Mb3455c
MSRVQISTVLAIDTATPAVTAGIVRRHDLVVLGERVTVDARAHAERLTPNVLAALADAALTMADLDAVVVGCGPGPFTGLRAGMASAAAYGHALGIPVYGVCSLDAIGGQTIGDTLVVTDARRREVYWARYCDGIRTVGPAVNAAADVDPGPALAVAGAPEHAALFALPCVEPSRPSPAGLVAAVNWADKPAPLVPLYLRRPDAKPLAVCT
Bibliography
No article yet recorded