Gene Rv3421c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3421c, (MTCY78.08), len: 211 aa. Conserved hypothetical protein, equivalent to Q49857|YY21_MYCLE|ML0378|B229_C1_170 hypothetical 38.0 KDA protein from Mycobacterium leprae (359 aa), FASTA scores: opt: 1000, E(): 1.8e-50, (75.6% identity in 205 aa overlap). Also similar to other hypothetical bacterial proteins e.g. O86791|SC6G4.28 from Streptomyces coelicolor (217 aa), FASTA scores: opt: 453, E(): 3.3e-19, (48.1% identity in 212 aa overlap); Q9AC10|CC0059 (glycoprotease family protein) from Caulobacter crescentus (211 aa), FASTA scores: opt: 248, E(): 2e-07, (34.3% identity in 210 aa overlap); Q9KQK9|VC1989 from Vibrio cholerae (237 aa), FASTA scores: opt: 238, E(): 8.2e-07, (28.85% identity in 208 aa overlap); BAB51966|Mlr5530 from Rhizobium loti (Mesorhizobium loti) (225 aa), FASTA scores: opt: 237, E(): 9e-07, (35.0% identity in 220 aa overlap); etc. Some similarity to upstream Q50709|GCP_MYCTU|Rv3419c|MT3528|MTCY78.10 from Mycobacterium tuberculosis (344 aa), (33.9% identity in 127 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3839059 | 3839694 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3421c|Rv3421c
MSRVQISTVLAIDTATPAVTAGIVRRHDLVVLGERVTVDARAHAERLTPNVLAALADAALTMADLDAVVVGCGPGPFTGLRAGMASAAAYGHALGIPVYGVCSLDAIGGQTIGDTLVVTDARRREVYWARYCDGIRTVGPAVNAAADVDPGPALAVAGAPEHAALFALPCVEPSRPSPAGLVAAVNWADKPAPLVPLYLRRPDAKPLAVCT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
