Gene Mb3456c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3456c, -, len: 168 aa. Equivalent to Rv3422c,len: 168 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 168 aa overlap). Conserved hypothetical protein, equivalent to Q49864|YY22_MYCLE|ML0377|U229F|B229_C2_205 HYPOTHETICAL 17.6 KDA PROTEIN from Mycobacterium leprae (161 aa), FASTA scores: opt: 752, E(): 8.3e-38, (77.4% identity in 146 aa overlap). Also similar to other hypothetical bacterial proteins e.g. O86788|YJEE_STRCO|SC6G4.25 from Streptomyces coelicolor (148 aa), FASTA scores: opt: 377, E(): 1.2e-15,(50.85% identity in 120 aa overlap); Q9X1W7|TM1632 from Thermotoga maritima (161 aa), FASTA scores: opt: 247, E(): 6.2e-08, (39.4% identity in 137 aa overlap); Q9RRY1|DR2351 from Deinococcus radiodurans (148 aa), FASTA scores: opt: 236, E(): 2.6e-07, (38.6% identity in 127 aa overlap); etc. Contains PS00017 ATP /GTP-binding site motif A. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3792319 | 3792825 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3456c|Mb3456c
MSREGIRRRPKARAGLTGGGTATLPRVEDTLTLGSRLGEQLCAGDVVVLSGPLGAGKTVLAKGIAMAMDVEGPITSPTFVLARMHRPRRPGTPAMVHVDVYRLLDHNSADLLSELDSLDLDTDLEDAVVVVEWGEGLAERLSQRHLDVRLERVSHSDTRIATWSWGRS
Bibliography
No article yet recorded