Gene Mb3488c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s11 rpsk |
| Comments | Mb3488c, rpsK, len: 139 aa. Equivalent to Rv3459c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 139 aa overlap). Probable rpsK, 30S ribosomal protein S11, equivalent to Q9X7A0|RS11_MYCLE|RPSK|ML1959|MLCB1222.29c 30S RIBOSOMAL PROTEIN S11 from Mycobacterium leprae (138 aa), FASTA scores: opt: 819, E(): 7.6e-44, (89.95% identity in 139 aa overlap); and P45812|RS11_MYCBO 30S RIBOSOMAL PROTEIN S11 from Mycobacterium bovis (139 aa), FASTA scores: opt: 867,E(): 8.4e-47, (94.25% identity in 139 aa overlap). Also highly similar to others e.g. P72403|RS11_STRCO|SC6G4.06 from Streptomyces coelicolor (134 aa), FASTA scores: opt: 729, E(): 2.6e-38, (79.85% identity in 139 aa overlap); O50633|RS11_BACHD|RPSK|BH0161 from Bacillus halodurans (129 aa), FASTA scores: opt: 618, E(): 1.7e-31, (70.3% identity in 128 aa overlap); P04969|RS11_BACSU|RPSK from Bacillus subtilis (131 aa), FASTA scores: opt: 601, E(): 2e-30, (69.0% identity in 129 aa overlap); etc. Contains ribosomal protein S11 signature (PS00054). BELONGS TO THE S11P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3826969 | 3827388 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3488c|rpsK
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPNRRRV
Bibliography
No article yet recorded