Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionS11 plays an essential role for the selection of the correct tRNA in protein biosynthesis. It is located on the large lobe of the small subunit.
Product30S ribosomal protein S11 RpsK
CommentsRv3459c, (MTCY13E12.12c), len: 139 aa. rpsK, 30S ribosomal protein S11, equivalent to Q9X7A0|RS11_MYCLE|RPSK|ML1959|MLCB1222.29c 30S ribosomal protein S11 from Mycobacterium leprae (138 aa), FASTA scores: opt: 819, E(): 7.6e-44, (89.95% identity in 139 aa overlap); and P45812|RS11_MYCBO 30S ribosomal protein S11 from Mycobacterium bovis (139 aa), FASTA scores: opt: 867, E(): 8.4e-47, (94.25% identity in 139 aa overlap). Also highly similar to others e.g. P72403|RS11_STRCO|SC6G4.06 from Streptomyces coelicolor (134 aa), FASTA scores: opt: 729, E(): 2.6e-38, (79.85% identity in 139 aa overlap); O50633|RS11_BACHD|RPSK|BH0161 from Bacillus halodurans (129 aa), FASTA scores: opt: 618, E(): 1.7e-31, (70.3% identity in 128 aa overlap); P04969|RS11_BACSU|RPSK from Bacillus subtilis (131 aa), FASTA scores: opt: 601, E(): 2e-30, (69.0% identity in 129 aa overlap); etc. Contains ribosomal protein S11 signature (PS00054). Belongs to the S11P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below).
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38792733879692-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3459c|rpsK
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV