Gene Rv3459c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | S11 plays an essential role for the selection of the correct tRNA in protein biosynthesis. It is located on the large lobe of the small subunit. |
| Product | 30S ribosomal protein S11 RpsK |
| Comments | Rv3459c, (MTCY13E12.12c), len: 139 aa. rpsK, 30S ribosomal protein S11, equivalent to Q9X7A0|RS11_MYCLE|RPSK|ML1959|MLCB1222.29c 30S ribosomal protein S11 from Mycobacterium leprae (138 aa), FASTA scores: opt: 819, E(): 7.6e-44, (89.95% identity in 139 aa overlap); and P45812|RS11_MYCBO 30S ribosomal protein S11 from Mycobacterium bovis (139 aa), FASTA scores: opt: 867, E(): 8.4e-47, (94.25% identity in 139 aa overlap). Also highly similar to others e.g. P72403|RS11_STRCO|SC6G4.06 from Streptomyces coelicolor (134 aa), FASTA scores: opt: 729, E(): 2.6e-38, (79.85% identity in 139 aa overlap); O50633|RS11_BACHD|RPSK|BH0161 from Bacillus halodurans (129 aa), FASTA scores: opt: 618, E(): 1.7e-31, (70.3% identity in 128 aa overlap); P04969|RS11_BACSU|RPSK from Bacillus subtilis (131 aa), FASTA scores: opt: 601, E(): 2e-30, (69.0% identity in 129 aa overlap); etc. Contains ribosomal protein S11 signature (PS00054). Belongs to the S11P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below). |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3879273 | 3879692 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3459c|rpsK
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
