Gene Mb3490c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l36 rpmj |
| Comments | Mb3490c, rpmJ, len: 37 aa. Equivalent to Rv3461c,len: 37 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 37 aa overlap). Probable rpmJ, 50S ribosomal protein L36, equivalent to P45810|RL36_MYCBO|RPMJ from Mycobacterium bovis (37 aa); and Q9X7A2|RL36_MYCLE|RPMJ|ML1961|MLCB1222.31c 50S RIBOSOMAL PROTEIN L36 from Mycobacterium leprae (37 aa),FASTA scores: opt: 241, E(): 9.7e-14, (86.5% identity in 37 aa overlap). Also highly similar to others e.g. O86772|RL36_STRCO|SC6G4.04 from Streptomyces coelicolor (37 aa), FASTA scores: opt: 233, E(): 4.5e-13, (83.8% identity in 37 aa overlap); P07841|RL36_BACST|RPMJ from Bacillus stearothermophilus (37 aa), FASTA scores: opt: 214, E(): 1.6e-11, (72.95% identity in 37 aa overlap); P12230|RK36_SPIOL|RPL36 from Spinacia oleracea (Spinach) (37 aa), FASTA scores: opt: 211, E(): 2.9e-11, (70.25% identity in 37 aa overlap); etc. Contains PS00828 Ribosomal protein L36 signature. BELONGS TO THE L36P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3827982 | 3828095 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3490c|rpmJ
MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
Bibliography
No article yet recorded
