Gene Mb3509c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN [SECOND PART] |
| Comments | Mb3509c, -, len: 274 aa. Equivalent to 3' end of Rv3480c, len: 497 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 274 aa overlap). Conserved hypothetical protein, similar to many from Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O69701|Y1D4_MYCTU|Rv3734c|MT3839|MTV025.082c (454 aa),FASTA scores: opt: 520, E(): 2e-23, (39.95% identity in 488 aa overlap); Q10554|Y895_MYCTU|Rv0895|MTCY31.23 (505 aa), FASTA scores: opt: 434, E(): 2.7e-18, (34.2% identity in 497 aa overlap); AAK45165|MT0919 (520 aa), FASTA scores: opt: 434, E(): 2.7e-18, (34.2% identity in 497 aa overlap); etc. Also similar to Q9X7A8|MLCB1610.05|ML1244 CONSERVED MEMBRANE PROTEIN from Mycobacterium leprae (491 aa), FASTA scores: opt: 272, E(): 1e-08, (28.85% identity in 485 aa overlap); and Q9RIU8|CM11.13c HYPOTHETICAL 47.1 KDA PROTEIN from Streptomyces coelicolor (446 aa), FASTA scores: opt: 254, E(): 1.1e-07, (30.4% identity in 497 aa overlap). SEEMS TO BELONG TO THE UPF0089 FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv3480c exists as a single gene. In Mycobacterium bovis, a frameshift due to a 2 bp deletion (gt-*) splits Rv3480c into 2 parts, Mb3509c and Mb3510c. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3844534 | 3845358 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3509c|Mb3509c
MAGAGRSTFELTKALVNAQLRSDHEYRNLVGSVQAPHCILNTRISRNRRFATQQYPLDRLKAIGAQYDATINDVALAIIGGGLRRFLDELGELPNKSLIVVLPVNVRPKDDEGGGNAVATILATLGTDVADPVQRLAAVTASTRAAKAQLRSMDKDAILAYSAALMAPYGVQLASTLSGVKPPWPYTFNLCVSNVPGPEDVLYLRGSRMEASYPVSLVAHSQALNVTLQSYAGTLNFGFIGCRDTLPHLQRLAVYTGEALDQLAAADGAAGLGS
Bibliography
No article yet recorded