Gene Mb3513c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible exported protein |
| Comments | Mb3513c, -, len: 220 aa. Equivalent to Rv3483c,len: 220 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 220 aa overlap). Conserved hypothetical protein, similar to Q9CC94|ML1099 PUTATIVE LIPOPROTEIN from Mycobacterium leprae (202 aa), FASTA scores: opt: 276, E(): 1.4e-08, (33.1% identity in 148 aa overlap). Also showing similarity with Mycobacterium tuberculosis proteins Q11065|LPRE_MYCTU|LPRE|Rv1252c|MT1291|MTCY50.30. PUTATIVE LIPOPROTEIN PRECURSOR (202 aa), FASTA scores: opt: 276,E(): 1.4e-08, (29.5% identity in 200 aa overlap); O53445|Rv1097c|MTV017.50c HYPOTHETICAL 29.9 KDA PROTEIN (293 aa), FASTA scores: opt: 161, E(): 0.047, (25.4% identity in 118 aa overlap); P71882|LPPP_MYCTU|Rv2330c|MT2392|MTCY3G12.04 PUTATIVE LIPOPROTEIN PRECURSOR (175 aa), FASTA scores: opt: 146,E(): 0.21, (28.25% identity in 184 aa overlap); and O06170|Rv2507|MTCY07A7.13 HYPOTHETICAL 28.5 KDA PROTEIN (273 aa), FASTA scores: opt: 148, E(): 0.23, (25.15% identity in 191 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3847773 | 3848435 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3513c|Mb3513c
MSDEIDPDWPAPAYQPSDDVDTTPPAPGGSWPTAWLVALVVLACVAAAVVAYAGMHRVRPGANQAAPATTSAPARPTSPASQVGPCGPDEATAVRAALAQLAPDSKTGRPWNSTPEDSNYDPCADLSAVLVTVQDATNSSPDQALMFHRGTFVGTATPRAYPFTNLIGPASTNDIVVLSYRTRQSCDGCQDGILTIVGFAWRGDHVQILDSLPELFDAPP
Bibliography
No article yet recorded