Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPossible exported protein
CommentsRv3483c, (MTCY13E12.36c), len: 220 aa. Possible exported protein, similar to Q9CC94|ML1099 putative lipoprotein from Mycobacterium leprae (202 aa), FASTA scores: opt: 276, E(): 1.4e-08, (33.1% identity in 148 aa overlap). Also showing similarity with Mycobacterium tuberculosis proteins Q11065|LPRE_MYCTU|LPRE|Rv1252c|MT1291|MTCY50.30. putative lipoprotein precursor (202 aa), FASTA scores: opt: 276, E(): 1.4e-08, (29.5% identity in 200 aa overlap); O53445|Rv1097c|MTV017.50c hypothetical 29.9 KDA protein (293 aa), FASTA scores: opt: 161, E(): 0.047, (25.4% identity in 118 aa overlap); P71882|LPPP_MYCTU|Rv2330c|MT2392|MTCY3G12.04 putative lipoprotein precursor (175 aa), FASTA scores: opt: 146, E(): 0.21, (28.25% identity in 184 aa overlap); and O06170|Rv2507|MTCY07A7.13 hypothetical 28.5 KDA protein (273 aa), FASTA scores: opt: 148, E(): 0.23, (25.15% identity in 191 aa overlap). Contains possible N-terminal signal sequence
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by SCOTS method, 48h after infection of cultured human primary macrophages (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39021503902812-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3483c|Rv3483c
VSDEIDPDWPAPAYQPSDDVDTTPPAPGGSWPTAWLVALVVLACVAAAVVAYAGMHRVRPGANQAAPATTSAPARPTSPASQVGPCGPDEATAVRAALAQLAPDSKTGRPWNSTPEDSNYDPCADLSAVLVTVQDATNSSPDQALMFHRGTFVGTATPRAYPFTNLIGPASTNDIVVLSYRTRQSCDGCQDGILTIVGFAWRGDHVQILDSLPELFDAPP