Gene Mb3516
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3516, -, len: 149 aa. Equivalent to Rv3486, len: 149 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 149 aa overlap). Conserved hypothetical protein, similar to Q9RC47|YFID|BH3304 HYPOTHETICAL PROTEIN from Bacillus halodurans (129 aa),FASTA scores: opt: 186, E(): 2.1e-05, (40.0% identity in 95 aa overlap); and Q9KKT1|VCA1019 HYPOTHETICAL PROTEIN from Vibrio cholerae (148 aa), FASTA scores: opt: 128,E(): 0.15, (35.25% identity in 139 aa overlap). Some similarity to other proteins e.g. P54720|YFID_BACSU HYPOTHETICAL PROTEIN from Bacillus subtilis (134 aa),FASTA scores: opt: 165, E(): 0.00052, (31.75% identity in 126 aa overlap). Equivalent to AAK47949 from Mycobacterium tuberculosis strain CDC1551 (163 aa) but shorter 14 aa. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3851395 | 3851844 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3516|Mb3516 MHAEGPPSVICIRLLVGLVFLSEGIQKFMYPDQLGPGRFERIGIPAATFFADLDGVVEIVCGTLVLLGLLTRVAAVPLLIDMVGAIVLTKLRALQPGGFLGVEGFWGMAHAARTDLSMLLGLIFLLWSGPGRWSLDRRLSKRATACGAR
Bibliography
No article yet recorded