Gene Rv3486
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved protein |
Comments | Rv3486, (MTCY13E12.39), len: 149 aa. Conserved protein, similar to Q9RC47|YFID|BH3304 hypothetical protein from Bacillus halodurans (129 aa), FASTA scores: opt: 186, E(): 2.1e-05, (40.0% identity in 95 aa overlap); and Q9KKT1|VCA1019 hypothetical protein from Vibrio cholerae (148 aa), FASTA scores: opt: 128, E(): 0.15, (35.25% identity in 139 aa overlap). Some similarity to other proteins e.g. P54720|YFID_BACSU hypothetical protein from Bacillus subtilis (134 aa), FASTA scores: opt: 165, E(): 0.00052, (31.75% identity in 126 aa overlap). Equivalent to AAK47949 from Mycobacterium tuberculosis strain CDC1551 (163 aa) but shorter 14 aa. |
Functional category | Conserved hypotheticals |
Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3905772 | 3906221 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3486|Rv3486 LHAEGPPSVICIRLLVGLVFLSEGIQKFMYPDQLGPGRFERIGIPAATFFADLDGVVEIVCGTLVLLGLLTRVAAVPLLIDMVGAIVLTKLRALQPGGFLGVEGFWGMAHAARTDLSMLLGLIFLLWSGPGRWSLDRRLSKRATACGAR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant