Gene Mb3530c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved integral membrane protein yrbe4b. possible abc transporter. |
| Comments | Mb3530c, yrbE4B, len: 280 aa. Equivalent to Rv3500c, len: 280 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 280 aa overlap). yrbE4B,hypothetical unknown integral membrane protein, part of mce4 operon and member of YrbE family (see citations below for more information), highly similar to Mycobacterium tuberculosis proteins O07413|Rv0168|MTCI28.08|yrbE1B (289 aa); O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa); and O53966|Rv1965|MTV051.03|yrbE3B (271 aa). Also highly similar to conserved hypothetical integral membrane proteins of the P45030|YRBE_HAEIN (261 aa) type, e.g. Q9CD15|YRBE1B|ML2588 from Mycobacterium leprae (289 aa),FASTA scores: opt: 973, E(): 1.5e-50, (50.2% identity in 269 aa overlap); P45030|YRBE_HAEIN|HI1086 from Haemophilus influenzae (261 aa), FASTA scores: opt: 270, E(): 6e-11,(25.4% identity in 264 aa overlap); etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3864843 | 3865685 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3530c|yrbE4B
MSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVRLVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALTGFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDHYFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG
Bibliography
No article yet recorded
